<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04AR160677 04AR160677 Argentina 2004 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, E13D, V37I, I60V, I84M, L101I, T112V, T124N, T125A, I135V, K136Q, V165I, V201I, A205S, I217V, T218S, L234V, D256E S283G
>04AR160677| codons 1-288
FLDGIDKAQEDHDKYHSNWRAMASDFNLPPVVAKEIIASCDKCQLKGEAMHGQVDCSPGV
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWAGVQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTKELQKQVSKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12I, I15V, E35D, M36I, L89M  
>04AR160677| codons 1-99
PQITLWQRPVVIIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, E28A, V35T, E36D, E40D, K49R, E169D, K173A, Q174K, G196E, T200A, Q207K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, E297T, D324N, I326V, I329L, M357I, A360T, E370D, T377L, T386I, Q394L, E399D, A400T, E404D, K431T, V435A, A446S, L452K, V466A, D471E, T477A, H483Q, K512T, L517T, S519N, A534S, V559I R211L
>04AR160677| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTAEKIKALTDICTDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRKHLLLWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKNLVAELQKQGQGQWTYQIYQEPFKNLKTGKYARIRGT
HTNDVKQLTDAVQKIALESIVIWGKIPKFKLPILKETWDTWWTDYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGLEVNIVTDSQYALGIIQAQPDTSESETVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006