<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04AR143170 04AR143170 Argentina 2004 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I D6N, K7E, E11D, D25DE, V31I, I72V, S119G, T122I, F181L, K211R, D256E  
>04AR143170| codons 1-288
FLDGINEAQEDHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGGN
FISTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, P39S, R57K, D60E, I62V, L63T, A71V, I72T, V77I, I93L  
>04AR143170| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMNLSGRWKPKMIGGIGGFIKVKQYE
QVTIEICGHKVTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, D123S, A158S, T200A, E204D, F214L, V245E, A272S, K277R, T286A, I293V, A327V, I329V, Q334H, R356K, T369A, T386I, K390R, A400T, V435I, E449D, V466A, S468P, H483Y, G490E, Q509H, S519N, Q524E, A554N, V559I  
>04AR143170| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEDLRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEVQKQGHGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLAEAVQKIATESIVIWGKIPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRDTKLGKAGYVTDRGRQKAVPLTDTTNQKTELQ
AIYLALQDSELEVNIVTDSQYALGIIQAHPDKSESELVNQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSNGIRKIL

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006