<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03AR138910 03AR138910 Argentina 2003 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E10D, D25E, I72V, L101I, T112I, S119P, T122I, T124A, T125A, V126A, K136Q, V165I  
>03AR138910| codons 1-288
FLDGIEKAQDEHEKYHSNWRAMASEFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGPN
FISAAAKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, L63P, V77I, I93L  
>03AR138910| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        A98S, K122E, T200V, K201I, V245L, I293V, P294Q, I329L, A360T, K390R, A400T, L452S, H483Y, L517I, S519N, A554K, K558R  
>03AR138910| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRVIIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVQLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKSGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSKGIRRVL

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006