<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
02AR114146 02AR114146 Argentina 2002 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, V37I, G59E, I72V, T112A, T124A, T125A, V201I, D253E S283G
>02AR114146| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIVAKEIIASCDKCQLKGEAMHGQVDCSPEI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKAIHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, I62V, L63Q, I64V, I72M, V77I  
>02AR114146| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVQVEICGHKAMGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135T, R211K, L228F, Y271F, A272P, I293V, D324E, Q334E, T369A, K374R, I375V, A376T, T386I, K390R, A400T, V435A, L452S, S468P, H483Y, S519N, V559I  
>02AR114146| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFFWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIFPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLAEAVQRVTTESIVIWGKIPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKSGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKIL

References
Author Title Citation
Pando, MA First report of an HIV-1 triple recombinant of subtypes B, C and F in Buenos Aires, Argentina. Retrovirology, 2006