<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt244 1192M3M South Africa 1999 HIV1 C PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, D25E, V31I, V37I, M50I, I72V, I84M, F100Y, L101I, T112V, T124A, T125A, K136Q, V201I, T206S, T218I, L234I, D278A S283G
>1192M3M| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASEFNLPPIVAKEIIASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, R41K, K43R, H69K, I93L  
>1192M3M| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, V35T, E36A, T39E, S48T, K122E, D123S, K173A, Q174A, D177E, T200A, E204K, Q207E, F214L, P243A, V245Q, A272P, K275Q, K277R, T286A, E291D, V292I, I293V, Q334E, R356K, G359T, T377V, K390R, A400I, E404D, V435A, L452K, S468T, L469I, T470S, D471E, H483Q, L491S, S519N, K530R, A534S, A554N  
>1192M3M| codons 1-560
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAANPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAVESIVIWGKTPKFRLPIQKETWEIWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKKGKAGYVTDRGRQKVVTISETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006