<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt157 04PS199B1 South Africa 2004 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, I72V, F100Y, L101I, T112V, T124N, T125A, K136Q, V201I, K215N, L234I, A265V, R269K, D278A D288N
>04PS199B1| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQNQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVASRQDEN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, M36I, R41K, H69K, L89M, I93L  
>04PS199B1| codons 1-99
PQITLWQRPLVTIKIGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32R, V35T, T39K, S48T, V60I, K122E, K173A, D177E, T200A, Q207E, R211K, V245Q, A272P, T286A, E291D, V292I, I293V, P294L, Q334Y, G335D, R356K, M357R, G359T, K390R, A400L, E404D, I434V, V435A, N447T, L452I, T470S, D471E, T477A, H483Q, L491S, V493A, S519N, K530R, A554K E89G, Y232C
>04PS199B1| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTEICKEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWGVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGCELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVLLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGYDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWELWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPVAGAETFYVDGAATRETKIGKAGYVTDRGRQKVVSLSETTNQKAELQ
AIQLALQDSGSEANIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSKGIRKVL

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006