<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4736 CA69140 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT+IDV 52
3 PI+RTI 470
4 EFV+FTC+RTV+TDF+TPV 30
5 DRV+FTC+RTV+T20+TDF 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54L, I84V, L90M V11I, L33F, G73S, L89V L10V, I13V, K14R, I15V, K20T, M36I, R41K, R57K, D60E, L63P, G68E, K70T, A71I, I72IM, I93L  
>CA69140| codons 1-99
PQITLWQRPVITVRVGGQLTEALLDTGADDTIFEEINLPGKWKPKLIGGIGGFLKVKQYE
QIPIEICEHTIMSTVLVGPTPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, V75VIM, M184V, L210W, T215Y K219E G190S A98G S3C, T39N, K43E, E44A, T69TA, V106I, D123E, I142V, V179I, T200A, I257L, T286A, V292I, I293V W229WR
>CA69141| codons 1-305
PICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEEAGKISKIGPENPYNTPV
FAIKKKNSAKWRKIMDFRELNKRTQDFWEVQLGIPHPGGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVSSDLEIGQHRAKIEELRQHLWRWGFYTPDEKHQKEPPFLRMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010