<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA30205 CA69087 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC+AZT+NFV 295

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y K219R     V60VI, K122E, I135T, G196E, T200A, H208HY, D218E, V245L, E248D, Q278E  
>CA69087| codons 1-290
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQYLLRWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQPILLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14R, I15V, K20T, I62IV, L63P, A71IV, T74S, V77I, I93IL  
>CA69086| codons 1-99
PQITLWQRPLVTVRVGGQLTEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGSVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009