<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA30065 CA68805 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+D4T+EFV 213
3 3TC+NVP+TDF 73

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, L210W T215S V106A F227L V35M, T39A, K122E, T200I, R211K, V245K, D250E, A272P, K277R, V292I, P294ST, E297R  
>CA68805| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLWKWGFSTPDKKHQKEPPLLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIITLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12V, E35D, M36I, R41K, I62V, L63P  
>CA68804| codons 1-99
PQITLWQRPLVVIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012