<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA25081 CA68752 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA
2 Unknown 58
3 3TC+LPV+TDF 35
4 FTC+RTV+T20+TDF+TPV 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M   L10I, L19I, K20R, E34D, E35D, M36I, R41K, L63P, A71T, I85V, I93L  
>CA68752| codons 1-99
PQITLWQRPIVTIKIGGQIREALLDTGADDTVLDDINLPGKWKPKIVGGIGGFMKVRQYD
QIPIEICGHKTIGTVLVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     V35I, S48T, K122E, I135T, E169D, H208Y, R211K, D218E, L228H  
>CA68753| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKITKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLV

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010