<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14457 CA68683 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 207

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V21VI, K122P, I142V, D177E, I178V, V179I, I202V, R211K, S251T, A272AP, K277R, T286A, S322T, Q334E, S379G, V381I, K390R, V435VI, E449D, S519N, A554H, K558R  
>CA68683| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDTWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATEGIIIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRDTKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSHGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88NS L33LI A22AV, E35D, N37AD, R41RK, L63LP, A71V, I93L  
>CA68682| codons 1-99
PQITLWQRPLVTIKIGGQLKEVLLDTGADDTVIEDMDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009