<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1499 CA68661 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 44
2 DDI 126
3 D4T 52
4 3TC+D4T 65
5 3TC+D4T+IDV 58
6 D4T+NFV+NVP 63
7 3TC+D4T+EFV+RTV+SQV 13
8 APV+D4T+EFV+NFV 30
9 APV+D4T+NFV 28
10 None 56
11 D4T+DDI+LPV 20
12 3TC+ABC+DDI+LPV+TDF 228

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K103N, Y181C, G190A A98G K20R, V35M, T39A, K43E, E44D, K64KR, K102Q, V118I, D123E, Q174R, D177E, V189VI, G196E, E203K, Q207E, H208Y, R211K, K223Q, A272P, T286A, E297R V111VIM
>CA68661| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEEDGKISKIGPENPYNTPV
FAIRKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKQNKSVTVLDMGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIVI
CQYVDDLYIASDLEIEQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTREA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L10F, V11I, L33F, Q58E, G73S, L89V I13IV, K20R, E35D, M36I, N37Q, R57K, D60E, I62V, L63P, A71V, V77T, I93L  
>CA68660| codons 1-99
PQITLWQRPFITVKIGGQLREALLDTGADDTIFEDIQLPGRWKPKIVGGIGGFLKVKEYE
QVPIEICGHKVISTVLTGPTPVNVIGRNVMTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, I72V, L101I, K111T, T122I, K188R, V201I  
>CA124176| codons 1-288
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVTTIHTDNGSN
FISTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012