<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8402 CA68638 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 91
2 3TC+AZT+IDV 174
3 DDI+EFV+LPV 39
4 DDI+EFV+LPV+TDF 100
5 3TC+APV+DDI+LPV+TDF 61
6 3TC+APV+DDI+APV+LPV+TDF 3
7 3TC+DDI+APV+LPV+TDF 49
8 FTC+RTV+T20+TDF+TPV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, T74P L10I, I13V, N37ND, I62V, L63P, I93L  
>CA68638| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKAIGPVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, T215Y   K103N   E6D, V35VL, T39TA, S68SG, A98AS, I142V, V179VI, T200TA, I202IV, E203Q, Q207D, A272P, R284K, T286A, I293V  
>CA68639| codons 1-301
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKVQELRDHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009