<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1590 CA68617 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 139
2 AZT+DDC+IDV 26
3 D4T+DDC+IDV 52
4 3TC+DDI+RTV+SQV 22
5 D4T+DDI+IDV+NFV 58
6 ABC+APV+NVP+RTV 333
7 ABC+APV+NVP+RTV 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219N K101E, Y181C, M230L   E44D, V60I, K66R, V118I, K122E, I135T, G196E, T200I, E203K, Q207D, H208Y, R211K, K223E, L228R, A272P, T286TP  
>CA68617| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKRNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRIKIKELRDYLWKWGFYTPDNKHQEEPPFRWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82L, L90M L33F, G73T, L89V L10I, V11L, T12E, I13V, L19M, M36I, R41K, L63P, A71V, V77I, I93L  
>CA68616| codons 1-99
PQITLWQRPILEVKIGGQMKEALLDTGADDTVFEEINLPGKWKPKIIGGVGGFVKVRQYD
QIPIEICGHKVITTVLIGPTPLNIIGRNVMTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012