<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1340 CA68609 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 Unknown 496

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219KE G190A K101H E28K, K32E, V35T, T39K, K43E, K49R, V60I, V118I, K122E, T139TAS, S162SDGN, I178F, G196E, T200K, L205F, Q207E, H208Y, L228H, Q242L, A272P, A288AS, I293V, E297A  
>CA68609| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICKELEEEGKISRIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNESPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDFVI
YQYVDDLYVASDLEIEQHRKKIEEFREYLWRWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VLPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L10F, L24I, G73C I13V, K20I, M36I, D60E, L63P, I64V, I66V, A71T, I72T, T91S  
>CA68608| codons 1-99
PQITLWQRPFVTVKIGGQLIEALIDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYE
QIPVEVCGHKTTCTVLVGPTPVNVIGRNLLSQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012