<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7849 CA68594 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 130
2 ABC+APV+D4T+DLV 65
3 3TC+ABC+D4T+LPV+SQV 291
4 3TC+ABC+FTC+TDF 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, G48M, I54V, V82T, I84V K43T, F53L L10I, K20R, E35D, M36I, I62V, L63P, I66F, A71V, Q92R  
>CA68594| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWTPKMVMGIGGLVKVRQYD
QVPIEFCGHKVIGTVLVGPTPTNVIGRNLLTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, M184V, T215F D67G, K219E K103KN   V35IT, K43Q, S68G, T69A, S117SA, V118I, D121Y, K122E, I142V, R172RK, D177G, V179I, T200A, E203EA, H208Y, L210F, R211K, D218E, L228H, A272P, K277R, Q334L  
>CA68595| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEQEGKISKIGPENPYNTPV
FAIKKKGGARWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFAIPL
YEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPGIII
YQYVDDLYVGSDLEIGQHRAKIAELRQYLFKWGFFTPEEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3E, E10D, I72V, L101I, M154L, D256E  
>CA124155| codons 1-288
FLEGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESLNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010