<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4501 CA68580 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+ DDC 74
3 AZT+ 3TC 21
4 3TC+ AZT+ RTV 13
5 3TC+ AZT+ IDV 43
6 DDI+ DLV+ NFV 156
7 APV+ RTV+ ABC+ D4T 44
8 Unknown 289

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37D, R41K, I62V, L63P, I93L, C95F  
>CA68580| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219Q K103N   V60I, V118I, K122E, I135T, D218E, A272P, K277R, E297Q  
>CA68581| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTQEAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010