<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3972 CA68568 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT+IDV 104
3 AZT+D4T+SQV 87
4 3TC+AZT+NFV 48
5 3TC+AZT+IDV+RTV 40
6 ABC+APV+D4T 67
7 3TC+EFV+IDV+RTV 97
8 3TC+AZT+TDF 57
9 3TC+ATV+RTV+TDF 118
10 ABC+FTC+RTV+T20+TDF+TPV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82L, L90M Q58QE, T74P L10I, I13V, K20I, L33V, E35D, M36I, N37T, I62V, L63P, I64IV, A71V, I93L  
>CA68568| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVVEDITLPGRWKPKIIGGIGGFVKVREYD
QVPVEICGHKVIGPVLVGPTPLNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219D   K101H V35VI, K43E, T69TA, V118I, K122E, S162C, E169D, H208Y, R211K, D218E, V245M, T286A, I293V, Q334E, R358K, K366R E40FL
>CA68569| codons 1-368
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTLLEEEGKISKIGPENPYNTPV
FAIKKKNSAKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPEDKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVRQL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, K156N, A169V, T218S, L234H  
>CA124198| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQVRDQVEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQISKIQNFRVYYRDSRDPHWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010