<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3914 CA68561 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 111
2 AZT+DDC 39
3 3TC+AZT 31
4 3TC+D4T 37
5 AZT+DDI+NFV 77
6 3TC+AZT+EFV+NFV 91
7 APV+D4T+DDI 31
8 ABC+APV+D4T+DDI+LPV 61
9 ABC+DDI+TDF 78
10 3TC+AZT+DDI+LPV+TDF 100
11 ATV+AZT+FTC+RTV+TDF 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69DN, K70R, M184V D67G, K219Q Y188L A98G K64R, I142V, G196E, R211A, F214L, V245T, K275R, Q278E, I293V, E297K  
>CA68561| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIEQHRTKIEELRQHLLAWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIRVKELCKLLRGTKALTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46I, L90M G73GC, T74P L10LI, L33M, R41K, K43KR, I62V, L63P, C67CF, A71IT, I72V, V77I, I93L  
>CA68560| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIMEEMNLPGKWRPKIIGGIGGFIKVRQYD
QVPIEIFGHKTVCPVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009