<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1601 CA68558 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDC+ AZT 17
2 IDV+ D4T+ 3TC 87
3 EFV+ DDI+ ADV 35
4 ABC+ D4T+ RTV+ IDV 130
5 TDF+ LPV+ DDI 29
6 Unknown 195

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T I13M, K20I, M36I, N37D, I62V, L63P, I66IV, C67F, A71T, I72T, I93L  
>CA68558| codons 1-99
PQITLWQRPFVTMKIGGQLIEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVKVRQYD
QVPIEVFGHKTTTTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210LW, T215Y D67G, K219R     K20KR, V21VI, V35M, T39A, K43Q, E44D, V118I, K122E, I135IM, G196E, T200A, E203D, L205F, Q207E, H208Y, R211K, D218E  
>CA68559| codons 1-252
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALMEICAELEQDGKISKIGPENPYNTPV
FAIKKKGSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIDEFREYLWKWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010