<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
POB_04J8832ZA 04J8832ZA South Africa 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   T12S, I15V, L19I, N37S, R41K, H69K, V77I, V82I, L89M, I93L  
>04J8832ZA| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEMSLPGKWKPKLIGGIGGFIKVRQYD
QILIEICGKKAIGTVLIGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V90I, K122E, D123S, I135V, A158P, S162C, K173T, D177E, I178M, V179I, T200A, Q207K, R211A, V245K, A272S, K281R, T286A, E291D, V292I, I293V  
>04J8832ZA| codons 1-317
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPPIFQCSMTKILEPFRTQNPEMII
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGV

References
Author Title Citation
Bessong, PO Resistance mutational analysis of HIV type 1 subtype C among rural South African drug-naive patients prior to large-scale availability of antiretrovirals. ARHR, 2006