<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
POB_02TS26ZA 02TS26ZA South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, K20R, M36I, R41K, L63S, H69K, L89M, I93L  
>02TS26ZA| codons 1-99
PQITLWQRPLVSIKVGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, T27A, V35T, E36A, T39E, K122E, D123S, K166R, E169D, K173A, Q174R, D177E, G196E, T200A, Q207E, R211K, F214L, V245Q, A272P, K277R, E291D, V292I, I293V  
>02TS26ZA| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLAEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILDPFRARNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
L

References
Author Title Citation
Bessong, PO Resistance mutational analysis of HIV type 1 subtype C among rural South African drug-naive patients prior to large-scale availability of antiretrovirals. ARHR, 2006