<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
POB_02TS19ZA 02TS19ZA South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19I, M36I, R41K, D60E, L63P, H69K, L89I, I93L  
>02TS19ZA| codons 1-99
PQITLWQRPLVTVKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, E36A, T39E, S48T, V60I, K64R, K122E, D123S, K166R, K173T, T200A, Q207E, R211K, K277R, T286A, E291D, V292I, I293V  
>02TS19ZA| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKAICEEMEKEGKITKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Bessong, PO Resistance mutational analysis of HIV type 1 subtype C among rural South African drug-naive patients prior to large-scale availability of antiretrovirals. ARHR, 2006