<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
POB_01PB6ZA 01PB6ZA South Africa 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      Y318F V35T, T39E, S48T, V118I, K122E, D123N, E138A, I142V, E169Q, K173T, Q174R, T200A, Q207E, R211K, F214L, V245Q, E248N, A272P, K275R, Q278H, T286A, E291D, V292I, I293V, Y319F  
>01PB6ZA| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILQPFRTRNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVFF

References
Author Title Citation
Bessong, PO Resistance mutational analysis of HIV type 1 subtype C among rural South African drug-naive patients prior to large-scale availability of antiretrovirals. ARHR, 2006