<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
POB_01PB34ZA 01PB34ZA South Africa 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27S, V35T, T39K, S48T, V60I, V118I, K122E, D123S, E138A, E169Q, K173T, Q174R, T200A, Q207E, R211K, F214L, V245L, E248D, A272P, K275R, K277R, Q278H, T286A, E291D, V292I, I293V  
>01PB34ZA| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICKEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILQPFRTRNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPDKDSWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73S T12S, K14N, I15V, L19T, K20R, M36I, N37D, R41K, D60E, H69K, L89I, I93L  
>01PB34ZA| codons 1-99
PQITLWQRPLVSINVGGQTREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYE
QILIEICGKKAISTVLVGPTPVNIIGRNILTQLGCTLNF

References
Author Title Citation
Bessong, PO Resistance mutational analysis of HIV type 1 subtype C among rural South African drug-naive patients prior to large-scale availability of antiretrovirals. ARHR, 2006