<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
POB_01PB16ZA 01PB16ZA South Africa 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, M36T, N37T, P39S, R41K, D60E, Q61E, L63S, H69K, T74A, L89M, I93L  
>01PB16ZA| codons 1-99
PQITLWQRPLVSIKVEGQIKEALLDTGADDTVLEETTLSGKWKPKMIGGIGGFIKVRQYE
EISIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36A, T39E, S48T, K122E, D123N, K173I, T200A, Q207A, R211K, V245L, A272P, K277R, E291D, V292I, I293V  
>01PB16ZA| codons 1-316
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHG

References
Author Title Citation
Bessong, PO Resistance mutational analysis of HIV type 1 subtype C among rural South African drug-naive patients prior to large-scale availability of antiretrovirals. ARHR, 2006