<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LYH_AY870195 BAA161379 Singapore 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, G16E, K20R, E35D, M36I, R41K, R57K, H69K, L89M, I93L  
>BAA161379| codons 1-99
PQITLWQRPLVIIKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, K20R, V35T, T39K, K43E, V60I, V106I, D121DH, K122E, D123S, R172RK, K173I, Q174K, D177E, I178LV, V179I, T200TI, Q207A, R211S, K238KR, V245E, E291D, I293V, E312T, I326V, I329V, G335D, M357K, G359S, K366R, A371V, K390R  
>BAA161379| codons 1-399
PISPIDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKIKNPEVII
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Hsu, LY Characterization of mutations in CRF01_AE virus isolates from antiretroviral treatment naive and experienced patients in Singapore. JAIDS, 2005