Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| EV36 | EV36_W24 | U.S. | 1992 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 8 |
| 2 | SQV | 24 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V | T12P, L19X, E35D, L63P, E65D, A71T, V77I |
| >EV36_W24| codons 1-99 PQITLWQRPLVPIKIGGQXKEALLDTGADDTVLEDMNLPGRWKPKMIVGIGGFIKVRQYD QIPIDICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Schapiro, JM | The effect of high-dose saquinavir on viral load and CD4+ T-cell counts in HIV-infected patients. | Ann Intern Med, 1996 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |