<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SKR_103563 SKR_103563 India 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, T39E, S48T, K104N, V118I, K122E, D123S, I135T, K173A, Q174K, D177E, E194K, T200A, Q207G, R211K, F214L, V245Q, A272P, K277R, E291D, V292I, I293V, E297A, V317A, G335D, I341V, R356K, G359T, T377M  
>SKR_103563| codons 34-386
LIEICEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLG
IPHPAGLKKKNSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGW
KGSPAIFQSSMTKILEPFRAKNPEIVIYQYMDDLYVGSDLKIGQHRAKIEELRGHLLKWG
LTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPG
IKVRQLCKLLRGTKALTDIVPLTAEAELELAENREILKEPVHGAYYDPSKDLIAEIQKQG
QDQWTYQVYQEPFKNLKTGKYAKMRTAHTNDVKQLTEAVQKIAMESIVIWGKT

References
Author Title Citation
Ravuri, SK Primary drug resistance studies by genotypic analysis in HIV-1 Indian subtype C-infected individuals. Direct Genbank Submission, 2006