<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG303_495 495RT_bl U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 169
2 AZT+DDI 168

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       T39A, K43E, E44A, V118I, D123E, I142V, S162D, I178M, G196E, T200A, Q207E, R211K, V245T, I293V D256DY
>495RT_bl| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNYIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELA

References
Author Title Citation
Albrecht, M Effect of lamivudine in HIV-infected persons with prior exposure to zidovudine/didanosine or zidovudine/zalcitabine. ARHR, 2000