<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG303_4803 4803RT_bl U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 170

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       K43M, V118I, K166R, R211K, K277R, T286A, P294T, E297K  
>4803RT_bl| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEMEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVITLTKEAE
LEL

References
Author Title Citation
Albrecht, M Effect of lamivudine in HIV-infected persons with prior exposure to zidovudine/didanosine or zidovudine/zalcitabine. ARHR, 2000