<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG303_2977 2977RT_f1 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 105
2 AZT+DDI 154
3 3TC+AZT+DDI 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R     K20R, V35M, K43E, E44A, A98S, T107TP, V118I, E204K, R211D, L228H, A272P, T286A  
>2977RT_f1| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVPVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEKLRQHLWDWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LE

References
Author Title Citation
Albrecht, M Effect of lamivudine in HIV-infected persons with prior exposure to zidovudine/didanosine or zidovudine/zalcitabine. ARHR, 2000