<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG303_1934 1934RT_f1 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 140
2 3TC+AZT+DDI 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V V75I, F77L, F116Y     K49R, I50V, S68G, V90I, K122E, E169D, T200A, Q207E, R211K, V245M, E248D, D250DE, A272P, K277R, T286A, A288S, V292I, E297K  
>1934RT_f1| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRVGPENPYNTPV
FAIKKKDGTKWRKLIDLRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEIIPLTKEAE
LEL

References
Author Title Citation
Albrecht, M Effect of lamivudine in HIV-infected persons with prior exposure to zidovudine/didanosine or zidovudine/zalcitabine. ARHR, 2000