<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG303_1934 1934RT_bl U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 138

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M V75I, F77L, F116Y     K49R, I50V, S68SG, K122E, E169D, T200A, Q207E, R211K, V245VM, E248DN, A272P, K277R, L279X N81NI
>1934RT_bl| codons 1-279
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRVGPENPYNTPV
FAIKKKDGTKWRKLIDLRELIKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVRQF

References
Author Title Citation
Albrecht, M Effect of lamivudine in HIV-infected persons with prior exposure to zidovudine/didanosine or zidovudine/zalcitabine. ARHR, 2000