<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG303_1349 1349RT_bl U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 136

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, Y115F, Q151M V75I, F77L, F116Y, K219E     K66KN, S68G, T107P, D123E, S162T, V245M K20KN, Y56YD, K220KN
>1349RT_bl| codons 1-252
PISPIETVPVKLKPGMDGPNVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPDNTPV
FAIKKNDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVPVLDVGDAFYSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQTSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDENHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSW

References
Author Title Citation
Albrecht, M Effect of lamivudine in HIV-infected persons with prior exposure to zidovudine/didanosine or zidovudine/zalcitabine. ARHR, 2000