<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_3620 3620RT_bl U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 DDI 165

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V V75T, K219Q     V35I, R83K, K104N, D123E, S162C, I178L, G196E, Q207R, F214FL, A272P, K277R  
>3620RT_bl| codons 1-278
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKVTDFRELNKKTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIEQHRTKIEELRRHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQ

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001