<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_3588 3588RT_f1 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 DDI 136
3 3TC+AZT+DDI 34
4 None 5
5 3TC+AZT+DDI 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F A62V, D67E     V35I, T69S, I135T, A158AS, K173N, G196E, A272P, K277R, Q278H, E297K K20KT
>3588RT_f1| codons 1-303
PISPIETVPVKLKPGMDGPTVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIKKKESSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRNQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVIPLTKEAE
LEL

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001