<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_3300 3300RT_bl U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 102
2 DDI 170

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y       K11R, V35I, K43KE, S48T, R83K, V90I, K101R, K102KE, S134R, S162H, K166R, K173KI, G196E, A272P, V276VA, K277R, K281KR, A288AS, I293IV, E297R D76DE, N137NDGS, K287KN
>3300RT_bl| codons 1-303
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALIEICTELEEEGKITKIGPENPYNTPV
FAIKKKNSTRWRKLVEFRELNKKTQDFWEIQLGIPHPAGLREKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPRINSETPGIRYQYNVLPQGWKGSPAIFQHSMTRILEPFRIQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKARQLCRLLRGTNSLTEVVPLTREAE
LEL

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001