<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_3142 3142RT_f1 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 197
2 DDI 163
3 3TC+AZT+DDI 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184MV K219KQ     K20R, T39TA, T69TN, R83RK, K102Q, K104KN, I135T, E138A, K166KR, T200TA, R211RK, F214FL, I293V  
>3142RT_f1| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001