<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_3044 3044RT_bl U.S. 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 106
2 DDI 93

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215Y     V179VD K20R, T39TA, E53ED, K122E, I178M, T200TI, Q207E, R211Q, V245M, A272P, L283I, I293V E28E*
>3044RT_bl| codons 1-296
PISPIETVPVKLKPGMDGPRVKQWPLT*EKIKALVEICAELEKEGKISKIGPDNPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMDI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLQWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLT

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001