<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_2979 2979RT_f1 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 150
2 3TC+AZT+DDI 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75T, M184V A62AV     K49KR, K101KQ, S162SDGN, T200I, Q207E, R211K, F214L I37L, K166K*R
>2979RT_f1| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVELCTEMEKEGKISRIGPENPYNTPV
FVIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLV

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001