<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_2098 2098RT_f1 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 27
2 DDI 156
3 3TC+AZT+DDI 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     R83K, V90I, V118I, K122P, I135V, S162C, I178M, G196E, E203V, A272P, K277R, I293V, P294T T139HN, E300E*
>2098RT_f1| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSVNNENPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIEQHRTKIVELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVTLTEEA*
LE

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001