<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG302_1889 1889RT_f1 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 DDI 159
3 3TC+AZT+DDI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K20R, E44D, R83K, V118I, K122E, I135V, E169D, K223Q, L228H  
>1889RT_f1| codons 1-267
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQQEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWA

References
Author Title Citation
Katzenstein, DA Virologic and CD4 cell response to zidovudine or zidovudine and lamivudine following didanosine treatment of human immunodeficiency virus infection. ARHR, 2001