<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt214 04SK191B1 South Africa 2004 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14N, L19I, M36I, L63V, H69K, T74S, L89M, I93L, C95R  
>04SK191B1| codons 1-99
PQITLWQRPLVTVNIGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGRTLNF

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006