<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt160 04PS204B1 South Africa 2004 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V60I, V118I, K122E, D123G, K173A, Q174K, D177E, T200A, Q207A, R211K, F214L, V245Q, A272K, K277R, K281R, T286A, E291D, V292I, I293V, Q334D, G335D, R356K, G359T, A371V, T377M, K388R, K390R, A400T, E404D, E413G, V435A, G436E, L452I, V466I, V467I, S468T, T470S, D471E, H483Q, L491S, S519N, K530R, A534S, A554S N306D
>04PS204B1| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYKGIKVRQLCRLLRGAKALTDIVPLTEEAE
LELAEDREILKEPVHGVYYDPSKDLIAEIQKQGDDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEVVQKIAMESIVIWGKTPRFRLPIQKETWETWWTDYWQATWIPGWEFVNTP
PLVKLWYQLEKEPIAEAETFYVDGAANRETKIGKAGYVTDRGRQKIITLSETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, K14R, I15V, L19M, M36I, R41K, L63P, H69K, L89M, I93L  
>04PS204B1| codons 1-99
PQITLWQRPLVAIRVGGQMKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V31I, K34R, M50I, T112V, T124N, T125A, K136Q, M178V, V201I, T218I, L234I, A265V, D278A, D279G S283G
>04PS204B1| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPIVAREIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQVAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGAGCVAGRQDED

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006