<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt77 03PS152MB1 South Africa 2003 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, E36A, T39E, E40D, V60I, W88C, K102R, V118I, K122E, D123G, I142T, K166R, K173A, Q174K, D177E, T200A, Q207E, R211K, F214L, V245Q, A272S, K277R, T286A, E291D, V292I, I293V, R356K, G359T, A360T, T369A, T377L, K390R, A400I, E404D, N418S, V435A, E449K, L452M, K465E, V466I, S468P, D471E, L491S, I506L, S519N, K530R, A534S, A554K  
>03PS152MB1| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTAICEDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKRKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRTT
HTNDVKQLAEAVQKIALESIVIWGKTPKFRLPIQKETWEIWWTDYWQATWIPEWEFVSTP
PLVKLWYQLEKEPIAGAETFYVDGAANRKTKMGKAGYVTDRGRQEIVPLTETTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGILQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSKGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, G16A, L19I, M36I, R41K, F53Y, H69K, V82I, L89M, I93L  
>03PS152MB1| codons 1-99
PQITLWQRPLVSIKIAGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGYIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006