<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt71 03PS131MB1 South Africa 2003 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, L19I, M36I, R41K, D60E, H69K, L89M, I93L  
>03PS131MB1| codons 1-99
PQITLWQRPLVTVKIEGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, V35T, E36A, T39E, K66E, K104R, K122E, D123N, A158S, K173T, Q174R, T200A, Q207E, R211K, F214L, V245L, A272P, K277R, T286A, E291D, V292I, I293V, Q334H, G335D, R356K, G359T, T377I, K390R, A400T, E404D, V435T, V466L, S468N, D471E, T477A, H483Q, L491S, S519N, K527N, K530R, V531I, A534S, A554K, I556V, K558R  
>03PS131MB1| codons 1-560
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKEDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTRNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAIESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPITGAETFYVDGAANRETKLGKAGYVTDRGRQKLVNLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKERIYLSWVPAHK
GIGGNEQVDKLVSKGVRRVL

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006