<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt64 03PS122MB1 South Africa 2003 HIV1 C Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36L, N37S, R41K, H69K, L89M, I93L  
>03PS122MB1| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48E, K122E, D123G, K166R, K173A, Q174K, T200A, Q207E, R211S, V245Q, A272S, T286A, E291D, V292I, I293V, P313T, Q334C, G335D, R356K, G359T, K366R, T369A, T377L, K390R, A400I, E404D, E413D, V435A, L452I, V466I, T470N, D471E, I482L, H483K, L491S, A502V, S519N, K530R, A534S, A554K  
>03PS122MB1| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKETVHGVYYDPSKDLIAEIQKQGCDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLAEAVQKIALESIVIWGKTPKFRLPIQKETWEIWWTDYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKIGKAGYVTDRGRQKIVSLNETTNQKTELQ
ALKLALQDSGSEVNIVTDSQYVLGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSKGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50I, F100Y, L101I, T112V, T124S, T125A, K136Q, V201I, T218I, L234I, A265V, R269K, D278A S283G
>03PS122MB1| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSSAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED

References
Author Title Citation
Rousseau, CM Large-scale amplification, cloning and sequencing of near full-length HIV-1 subtype C genomes. J Virol Methods, 2006