<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV_03BF-ORAV296 03BF-296 Burkina Faso 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, L63P, C67E, H69K, V77I, V82I, L89M  
>03BF-296| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEIEGKKAIGTVLIGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, A98S, I135V, I142V, S162A, Q174E, D177E, T200A, Q207A, R211K, V245Q, E248N, D250E, S251I, A272P, K275Q, K277R, K281R, T286A, E291D, V292I, I293V, K311R, D324E, E328D, G335D, F346Y, R356K, M357R, R358G, G359S, A371V, K390R, Q394R, E399D, A400V, E404D, Q428R, K431T, E432D  
>03BF-296| codons 1-433
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKENPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKEIWTVNDIQKLVGKLNWASQIYPGIQVRQLCRLLRGAKALTDIVPLTEEAE
LELAENREILREPVHGVYYDPSKELIADIQKQGQDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIRKETWDVWWTDYWQATWIPEWEFVNTP
PLVKLWYRLETDP

References
Author Title Citation
Vergne, L Natural polymorphism in protease and reverse transcriptase genes and in vitro antiretroviral drug susceptibilities of non-B HIV-1 strains from treatment-naive patients. J Clin Virol, 2006