<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV_03BF-ORAV186 03BF-186 Burkina Faso 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, V35T, E36D, V60I, S68G, K101Q, K122E, D123DN, I135V, E138A, S162A, K173A, Q174K, D177E, G196E, T200A, Q207E, R211K, F214L, P243S, V245EQ, T286A, E291D, V292I, I293V, P294T, E297KR, S322T, I326V, G335D, R356K, M357R, G359S, A371V, I375V, A376AG, T377IKM, V381VI, K390R, K395R, E396D, T403M  
>03BF-186| codons 1-428
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTREAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLTEVVQKVGMESIIIWGKTPKFRLPIQRDTWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G17GE, L19P, K20I, M36I, N37ND, R41RK, L63LP, I64M, H69K, K70KR, L89M  
>03BF-186| codons 1-99
PQITLWQRPLVTVKIGEQPIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIPMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vergne, L Natural polymorphism in protease and reverse transcriptase genes and in vitro antiretroviral drug susceptibilities of non-B HIV-1 strains from treatment-naive patients. J Clin Virol, 2006